Antibodies

Jump to Filters
View as table Download
Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Rabbit Polyclonal Antibody
TA350583

USD 380.00

In Stock

Rabbit Polyclonal Anti-UQCRC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCRC1
UQCRC2 Rabbit Polyclonal Antibody
TA350584

USD 380.00

In Stock

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCRC2
Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Rabbit Polyclonal Antibody
TA308378

USD 625.00

In Stock

Rabbit Polyclonal antibody to UQCRC1 (ubiquinol-cytochrome c reductase core protein I)

Applications WB
Reactivities Human, Mouse (Predicted: Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of UQCRC1 (Uniprot ID#P31930)
UQCRC2 Rabbit Polyclonal Antibody
TA338233

USD 539.00

5 Days

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV