Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-PPP2CB Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 292-306 amino acids of Human protein phosphatase 2, catalytic subunit, beta isozyme |
PPP2R1A sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH corresponding to amino acids 7-19 sequence (N-terminal) of PP2A/A regulatory subunit having a MW of 65kD |
PPP2R1B rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
PPP2R1B sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen used to the purified peptide conjugated to KLH corresponding to the sequence NH2-Phe-Ser-Gln-Val-Lys-Gly-Ala-Val-Asp-Asp-Asp-Val-Ala-Glu-COOH. This peptide antibody corresponds to N -terminal peptide of PP2A/B a regulatory subunit having a MW of 55kD. |
Rabbit anti-PPP2R1A Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP2R1A |
PP2A-alpha (PPP2CA) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The purified peptide conjugated to KLH. |
Goat Polyclonal Antibody against PPP2CA / PPP2CB
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Rabbit, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EPHVTRRTPDYFL, from the C Terminus of the protein sequence according to NP_002706.1; NP_004147.1. |
Rabbit Polyclonal Anti-PPP2CA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2CA Antibody is: synthetic peptide directed towards the N-terminal region of Human PPP2CA. Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI |
Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ |
Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL |
Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL |
Active filters
Category
-
Antibodies
- Primary Antibodies
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Phosphatase
Pathways
- Long-term depression