Antibodies

Jump to Filters
View as table Download
SMURF 2 (SMURF2) Rabbit Polyclonal Antibody
TA350762

USD 380.00

In Stock

Rabbit Polyclonal Anti-SMURF2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMURF2
Insulin (INS) Rabbit Polyclonal Antibody
TA350640

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-INS Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human INS
Insulin (INS) Rabbit Polyclonal Antibody
TA347869

USD 380.00

In Stock

Rabbit Polyclonal Anti-Insulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin
CD95 (FAS) Rabbit Polyclonal Antibody
TA323754

USD 380.00

4 Weeks

Anti-FAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6)
CD95 (FAS) Rabbit Polyclonal Antibody
TA313381

USD 380.00

In Stock

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.
CD95 (FAS) Rabbit Polyclonal Antibody
TA590390

USD 482.00

In Stock

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
Insulin (INS) Goat Polyclonal Antibody
AB0159-200

USD 355.00

In Stock

Goat Polyclonal Anti-INS Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human Insulin produced in E. coli as a fusion protein.
CD95 (FAS) Goat Polyclonal Antibody
TA305714

USD 520.00

5 Days

Goat Anti-FAS / CD95 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1.
CD95 (FAS) Rabbit Polyclonal Antibody
TA326787

USD 365.00

3 Weeks

FAS Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human FAS
CD95 (FAS) Rabbit Polyclonal Antibody
TA337864

USD 539.00

5 Days

Rabbit Polyclonal Anti-FAIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD
CD95 (FAS) Rabbit Polyclonal Antibody
TA354221

USD 425.00

5 Days

Rabbit anti CD95 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated