Antibodies

View as table Download

Rabbit Polyclonal Anti-PHKG1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHKG1

Rabbit polyclonal anti-PHKG1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PHKG1.

Rabbit Polyclonal Anti-PHKG1 Antibody - N-terminal region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phkg1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: REATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLT

Rabbit Polyclonal Anti-PHKG1 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Phkg1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Phkg1. Synthetic peptide located within the following region: NFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEV