Antibodies

Jump to Filters
View as table Download
ZNF195 Rabbit Polyclonal Antibody
TA343663

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZNF195 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF195 antibody: synthetic peptide directed towards the N terminal of human ZNF195. Synthetic peptide located within the following region: LTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLI
ZNF195 Rabbit Polyclonal Antibody
TA383528

USD 365.00

3 Weeks

ZNF195 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ZNF195 (NP_001123991.1).
Modifications Unmodified
ZNF195 Rabbit Polyclonal Antibody
TA339445

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZNF195 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF195 antibody: synthetic peptide directed towards the middle region of human ZNF195. Synthetic peptide located within the following region: QCEECGKVFRTCSSLSNHKRTHSEEKPYTCEECGNIFKQLSDLTKHKKTH
ZNF195 Rabbit Polyclonal Antibody
TA339446

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZNF195 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF195 antibody: synthetic peptide directed towards the N terminal of human ZNF195. Synthetic peptide located within the following region: GLDNLYLRKDWESLDECKLQKDYNGLNQCSSTTHSKIFQYNKYVKIFDNF
ZNF195 Rabbit Polyclonal Antibody
TA343400

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZNF195 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF195 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF195. Synthetic peptide located within the following region: EWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRKEPWNVK