SLC12A3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC12A3 |
SLC12A3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC12A3 |
Rabbit Polyclonal Anti-NCC Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AA74-95 (rat), 76-97 (hum) |
SLC12A3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC12A3 |
Rabbit Polyclonal Anti-SLC12A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC12A3 Antibody: synthetic peptide directed towards the middle region of human SLC12A3. Synthetic peptide located within the following region: ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC |
SLC12A3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SLC12A3. |
Anti-NCC (Thiazide sensitive NaCl cotransporter) (Thr53) Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr53 of mouse NCC, conjugated to keyhole limpet hemocyanin (KLH). |