Rabbit Polyclonal Anti-GPR85 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR85 antibody is: synthetic peptide directed towards the N-terminal region of Human GPR85. Synthetic peptide located within the following region: YFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCF |
GPR85 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 20 amino acid peptide from C-terminus of human GPR85 |
Rabbit Polyclonal Anti-GPR85 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SREB / GPR85 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human GPR85. Percent identity with other species by BLAST analysis: Human, Orangutan, Mouse, Rat, Turkey, Chicken, Lizard, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
Germany
Japan
United Kingdom
China
