Antibodies

Jump to Filters
View as table Download
FAR2 Rabbit Polyclonal Antibody
TA349964

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-FAR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FAR2
FAR2 Rabbit Polyclonal Antibody
TA364789

USD 380.00

4 Weeks

FAR2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FAR2
FAR2 Rabbit Polyclonal Antibody
TA342356

USD 539.00

5 Days

Rabbit Polyclonal Anti-MLSTD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MLSTD1 antibody: synthetic peptide directed towards the C terminal of human MLSTD1. Synthetic peptide located within the following region: WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM