Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CPT1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CPT1A Antibody: synthetic peptide directed towards the middle region of human CPT1A. Synthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN |
CPT1A (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CPT1A. |
CPT1A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human CPT1A |
CPT1A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse CPT1A |
