Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal HDAC4 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1049-1077 amino acids from the C-terminal region of human HDAC4. |
Rabbit Polyclonal Anti-Hdac4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hdac4 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac4. Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL |
HDAC4 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from Human HDAC4 around the phosphorylation site of Serine 632 (A-Q-Sp-S-P). |
HDAC4 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from Human HDAC4 around the phosphorylation site of Serine 632 (A-Q-Sp-S-P). |
HDAC4 (194-209) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding amino acids 194-209 of human HDAC4. |
Rabbit Polyclonal HDAC4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC4 |
Rabbit Polyclonal HDAC4 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
HDAC4 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 600-650 of Human HDAC4. |
Rabbit Polyclonal HDAC4 (Ser632) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC4 around the phosphorylation site of Serine 632 |
| Modifications | Phospho-specific |
HDAC4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 451-650 of human HDAC4 (NP_006028.2). |
| Modifications | Unmodified |
Active filters
Category
- Antibodies
Target Symbol
- HDAC4
Reactivities
- Human
Clonalities
- Polyclonal