Antibodies

Jump to Filters
View as table Download
UBE2D1 Rabbit Polyclonal Antibody
TA356291

USD 485.00

5 Days

UBE2D1 Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UBE2D1
UBE2D1 Rabbit Polyclonal Antibody
TA332474

USD 365.00

3 Weeks

Rabbit anti-UBE2D1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2D1
UBE2D1 Rabbit Polyclonal Antibody
TA329833

USD 485.00

5 Days

Rabbit Polyclonal Anti-MKRN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MKRN1 antibody: synthetic peptide directed towards the N terminal of human MKRN1. Synthetic peptide located within the following region: GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE