Antibodies

View as table Download

Rabbit Polyclonal Anti-REN Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human REN

Rabbit polyclonal anti-REN antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human REN.

REN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human REN

Rabbit Polyclonal Anti-REN Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REN antibody: synthetic peptide directed towards the C terminal of human REN. Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA