Antibodies

Jump to Filters
View as table Download
ME2 Rabbit Polyclonal Antibody
TA339737

USD 539.00

5 Days

Rabbit Polyclonal Anti-ME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ME2 antibody: synthetic peptide directed towards the N terminal of human ME2. Synthetic peptide located within the following region: MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG
ME2 (C-term) Rabbit Polyclonal Antibody
AP52647PU-N

USD 580.00

2 Weeks

ME2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 526-556 amino acids from the C-terminal region of Human NAD-ME