Antibodies

View as table Download

Rabbit Polyclonal Anti-NDUFA9 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFA9

Rabbit Polyclonal Anti-NDUFA9 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFA9

Rabbit polyclonal anti-NDUFA9 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA9.

Rabbit polyclonal Anti-NDUFA9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFA9 antibody: synthetic peptide directed towards the N terminal of human NDUFA9. Synthetic peptide located within the following region: QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY

Rabbit polyclonal anti-NDUFA9 antibody (Center)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This NDUFA9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 99-121 amino acids from the Central region of human NDUFA9.