Antibodies

Jump to Filters
View as table Download
CHST6 (C-term) Rabbit Polyclonal Antibody
AP50913PU-N

USD 580.00

2 Weeks

CHST6 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 303-333 amino acids from the C-terminal region of human CHST6
CHST6 Rabbit Polyclonal Antibody
TA312663

USD 380.00

In Stock

Rabbit polyclonal anti-CHST6 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHST6.
CHST6 Rabbit Polyclonal Antibody
TA346811

USD 539.00

5 Days

Rabbit Polyclonal Anti-CHST6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST6 antibody: synthetic peptide directed towards the middle region of human CHST6. Synthetic peptide located within the following region: YAFTGLSLTPQLEAWIHNITHGSGPGARREAFKTSSRNALNVSQAWRHAL
CHST6 Rabbit Polyclonal Antibody
TA346812

USD 539.00

5 Days

Rabbit Polyclonal Anti-CHST6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST6 antibody: synthetic peptide directed towards the middle region of human CHST6. Synthetic peptide located within the following region: QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN