Antibodies

View as table Download

Kininogen 1 (KNG1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 145-174 amino acids from the N-terminal region of Human Kininogen-1

Rabbit Polyclonal antibody to Kininogen 1 (kininogen 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 416 of HMW Kininogen

Rabbit anti-KNG1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KNG1

Rabbit polyclonal KNG1 (heavy chain, Cleaved-Lys380) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human KNG1.

Goat Anti-kininogen 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RITEATKTVGSDT, from the internal region (near N terminus) of the protein sequence according to NP_001095886.1; NP_000884.1; NP_001159923.1.

Goat Anti-kininogen 1 (aa268-279) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PRDIPTNSPELE, from the internal region of the protein sequence according to NP_001095886.1; NP_000884.1; NP_001159923.1.

Rabbit Polyclonal Anti-KNG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KNG1 antibody: synthetic peptide directed towards the middle region of human KNG1. Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK

KNG1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human KNG1

KNG1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1