Antibodies

Jump to Filters
View as table Download
Acyl coenzyme A Thioesterase 4 (ACOT4) Rabbit Polyclonal Antibody
TA316066

USD 380.00

In Stock

Rabbit polyclonal anti-ACOT4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACOT4.
Acyl coenzyme A Thioesterase 4 (ACOT4) Rabbit Polyclonal Antibody
TA344353

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACOT4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACOT4 antibody is: synthetic peptide directed towards the middle region of Human ACOT4. Synthetic peptide located within the following region: NALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH