Antibodies

Jump to Filters
View as table Download
FARSLA (FARSA) Rabbit Polyclonal Antibody
TA331202

USD 539.00

5 Days

Rabbit Polyclonal Anti-FARSA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FARSA antibody is: synthetic peptide directed towards the C-terminal region of Human FARSA. Synthetic peptide located within the following region: TFFLRDPAEALQLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLLR
FARSLA (FARSA) Rabbit Polyclonal Antibody
TA361693

USD 539.00

5 Days

FARSA Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FARSA