Rabbit Polyclonal Anti-GLS Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT |
Goat Polyclonal Anti-creatine kinase M-type (aa258-270) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-creatine kinase M-type (aa258-270) Antibody: Peptide with sequence C-QKIEEIFKKAGHP, from the internal region of the protein sequence according to NP_001815.2. |
Rabbit polyclonal anti-ALDH9A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ALDH9A1 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Antibody against Argininosuccinate synthetase 1
| Applications | WB |
| Reactivities | Human, Cow (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ENPKNQAPPGLYTKTQD, from the internal region of the protein sequence according to NP_000041.2 ; NP_446464.1. |
Goat Polyclonal Antibody against GOT1 (Internal region)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1. |
Goat Anti-Arginase I Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CFGLAREGNHKPID, from the C Terminus of the protein sequence according to NP_000036.2. |
Rabbit polyclonal antibody to ODC (ornithine decarboxylase 1)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Monkey, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 180 and 461 of ODC (Uniprot ID#P11926) |
GLUD1 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey, Mouse, Pig, Gibbon, Horse, Orang-Utan (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%). |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse, Orang-Utan, Guinea Pig (Predicted: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Rabbit Polyclonal nNOS Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human nNOS |
Rabbit Polyclonal iNOS Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human iNOS |
Rabbit Polyclonal eNOS (Ser1176) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human eNOS around the phosphorylation site of Serine 1176 |
| Modifications | Phospho-specific |
Rabbit Polyclonal eNOS (Thr494) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human eNOS around the phosphorylation site of Threonine 494 |
| Modifications | Phospho-specific |
Rabbit anti-GOT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GOT1 |
Rabbit anti iNOS Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-term of Mouse iNOS protein. |
Germany
Japan
United Kingdom
China
