Antibodies

Jump to Filters
View as table Download
PACRG (204-215) Rabbit Polyclonal Antibody
RA30023-50

USD 755.00

2 Weeks

PACRG (204-215) rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Rat, Zebrafish
Conjugation Unconjugated
PACRG Rabbit Polyclonal Antibody
TA319344

USD 765.00

5 Days

Rabbit polyclonal anti-PACRG antibody

Applications WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 204-215 of Human PACRG protein.
PACRG Rabbit Polyclonal Antibody
TA338842

USD 539.00

5 Days

Rabbit Polyclonal Anti-PACRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PACRG antibody: synthetic peptide directed towards the middle region of human PACRG. Synthetic peptide located within the following region: GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ
PACRG Rabbit Polyclonal Antibody
TA379568

USD 365.00

3 Weeks

PACRG Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human PACRG (NP_001073847.1).
Modifications Unmodified