Rabbit Polyclonal Anti-RPL36AL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL36AL antibody is: synthetic peptide directed towards the C-terminal region of Human RPL36AL. Synthetic peptide located within the following region: FRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQ |
RPL36AL Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human RPL36AL (NP_000992.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-RPL36AL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL36AL antibody is: synthetic peptide directed towards the C-terminal region of Human RPL36AL. Synthetic peptide located within the following region: RKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF |
Germany
Japan
United Kingdom
China
