Antibodies

Jump to Filters
View as table Download
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA344294

USD 539.00

5 Days

Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region

Applications IHC, IP, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA351749

USD 380.00

In Stock

Rabbit Polyclonal Anti-SPTAN1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SPTAN1
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA314562

USD 380.00

In Stock

Rabbit polyclonal SPTA2 (Cleaved-Asp1185) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen the antiserum was produced against synthesized peptide derived from human SPTA2.