Rabbit polyclonal PITX2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This PITX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-151 amino acids from the C-terminal region of human PITX2. |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2. Synthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PITX2 |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2. Synthetic peptide located within the following region: METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASS |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2. Synthetic peptide located within the following region: EFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQ |
Germany
Japan
United Kingdom
China
