Antibodies

Jump to Filters
View as table Download
E2F5 Rabbit Polyclonal Antibody
TA330135

USD 539.00

5 Days

Rabbit Polyclonal Anti-E2F5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F5 antibody: synthetic peptide directed towards the N terminal of human E2F5. Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN
E2F5 Rabbit Polyclonal Antibody
TA354388

USD 425.00

5 Days

Rabbit anti E2F-5 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated