Antibodies

Jump to Filters
View as table Download
OR8B4 Rabbit Polyclonal Antibody
TA316301

USD 380.00

In Stock

Rabbit polyclonal anti-OR8B4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR8B4.
OR8B4 Rabbit Polyclonal Antibody
TA337546

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR8B4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8B4 antibody is: synthetic peptide directed towards the C-terminal region of Human OR8B4. Synthetic peptide located within the following region: TYLTTSFPGSMNHGRFASVFYTNVVPMLNPSIYSLRNKDDKLALGKTLKR