Antibodies

Jump to Filters
View as table Download
MNK2 (MKNK2) Rabbit Polyclonal Antibody
TA333339

USD 539.00

5 Days

Rabbit Polyclonal Anti-MKNK2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MKNK2 Antibody: synthetic peptide directed towards the N terminal of human MKNK2. Synthetic peptide located within the following region: SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL
MNK2 (MKNK2) Rabbit Polyclonal Antibody
TA313959

USD 380.00

In Stock

Rabbit polyclonal anti-MNK2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MNK2.