Antibodies

Jump to Filters
View as table Download
BDNF Rabbit Polyclonal Antibody
TA346304

USD 539.00

5 Days

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA319220

USD 765.00

5 Days

Rabbit polyclonal PPAR Gamma 2 antibody

Applications WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the amino terminus of human PPAR gamma 2.