Rabbit Polyclonal Anti-AGK Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGK antibody: synthetic peptide directed towards the N terminal of human AGK. Synthetic peptide located within the following region: DNLLRRAACQEAQVFGNQLIPPNAQVKKATVFLNPAACKGKARTLFEKNA |
Goat Polyclonal Antibody against AGK
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDPRKREQMLTSP, from the C Terminus of the protein sequence according to NP_060708.1. |
Rabbit Polyclonal Anti-AGK Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGK antibody: synthetic peptide directed towards the N terminal of human AGK. Synthetic peptide located within the following region: KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE |
Germany
Japan
United Kingdom
China