Antibodies

View as table Download

Rabbit polyclonal antibody to ORC2 (origin recognition complex, subunit 2-like (yeast))

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 208 and 479 of ORC2 (Uniprot ID#Q13416)

Rabbit polyclonal ORC2L Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ORC2L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 208-237 amino acids from the Central region of human ORC2L.

Rabbit Polyclonal Anti-ORC2 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Orc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Orc2. Synthetic peptide located within the following region: LMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHV