Antibodies

Jump to Filters
View as table Download
C5R1 (C5AR1) (Center) Rabbit Polyclonal Antibody
AP50640PU-N

USD 580.00

2 Weeks

C5R1 (C5AR1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human C5AR1
C5R1 (C5AR1) Rabbit Polyclonal Antibody
TA328617

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-C5a Anaphylatoxin Receptor (extracellular)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)DKDTLDLNTPVDK, corresponding to amino acid residues 16-28 of human C5aR (Accession P21730 ). Extracellular, N-terminus.
C5R1 (C5AR1) Rabbit Polyclonal Antibody
TA340920

USD 515.00

5 Days

Rabbit Polyclonal Anti-C5AR1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen C5AR1 / CD88 / C5a Receptor antibody was raised against synthetic 18 amino acid peptide from internal region of human C5AR1 / CD88. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey (100%); Gibbon (89%).
C5R1 (C5AR1) Rabbit Polyclonal Antibody
TA342835

USD 539.00

5 Days

Rabbit Polyclonal Anti-C5AR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK
Prol1 (OPRPN) Rabbit Polyclonal Antibody
TA360484

USD 539.00

5 Days

OPRPN Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C5AR1