Antibodies

Jump to Filters
View as table Download
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA313641

USD 380.00

In Stock

Rabbit polyclonal anti-ABCC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC2.
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA350710

USD 380.00

In Stock

Rabbit Polyclonal Anti-ABCC2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC2
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA332361

USD 539.00

5 Days

Rabbit Polyclonal Anti-Abcc2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abcc2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA890096

USD 407.00

In Stock

Rabbit Polyclonal anti-ABCC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC2