Rabbit Polyclonal Anti-TRPM8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TRPM8 |
Rabbit Polyclonal Anti-TRPM8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TRPM8 |
Rabbit polyclonal TRPM8 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the Central region of human TRPM8. |
Rabbit Polyclonal Anti-TRPM8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP |