Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SQLE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE |
Rabbit Polyclonal Anti-DHCR24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the N terminal of human DHCR24. Synthetic peptide located within the following region: FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK |
Rabbit Polyclonal Anti-CYP51A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP51A1 antibody: synthetic peptide directed towards the N terminal of human CYP51A1. Synthetic peptide located within the following region: TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ |
Rabbit Polyclonal Anti-SC5DL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SC5DL Antibody: synthetic peptide directed towards the N terminal of human SC5DL. Synthetic peptide located within the following region: NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV |
Rabbit Polyclonal Anti-EBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EBP antibody: synthetic peptide directed towards the N terminal of human EBP. Synthetic peptide located within the following region: LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA |
Rabbit Polyclonal Anti-SC4MOL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SC4MOL antibody: synthetic peptide directed towards the N terminal of human SC4MOL. Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA |
Rabbit Polyclonal Anti-DHCR24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the middle region of human DHCR24. Synthetic peptide located within the following region: AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE |
Rabbit Polyclonal Anti-NSDHL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NSDHL antibody: synthetic peptide directed towards the middle region of human NSDHL. Synthetic peptide located within the following region: RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN |
Active filters
Category
- Antibodies
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- Steroid biosynthesis