USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Anti-SLC2A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4 |
Anti-SLC2A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4 |
Rabbit Polyclonal Anti-SLC2A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC2A4 Antibody: synthetic peptide directed towards the N terminal of human SLC2A4. Synthetic peptide located within the following region: LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSV |
Rabbit polyclonal PPP1R3A Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human (Predicted: Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This PPP1R3A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 754-782 amino acids from the Central region of human PPP1R3A. |
Rabbit Polyclonal PTP1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTP1B |
Goat Polyclonal Anti-INSR Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 1310 aa to the C-terminus of human INSR produced in E. coli. |
Rabbit polyclonal INSR (Ab-1375) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Stathmin around the phosphorylation site of threonine 1375 (I-L-TP-L-P). |
Rabbit Polyclonal IR (Tyr1355) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IR around the phosphorylation site of Tyrosine 1355 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTP1B (Ser50) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTP1B around the phosphorylation site of Serine 50 |
| Modifications | Phospho-specific |
Rabbit Polyclonal IR (Tyr1361) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IR around the phosphorylation site of Tyrosine 1361 |
| Modifications | Phospho-specific |
Rabbit Polyclonal IR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IR |
Rabbit Polyclonal Anti-PDE3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE3A antibody: synthetic peptide directed towards the N terminal of human PDE3A. Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD |
Rabbit Polyclonal Anti-PDE3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN |
Germany
Japan
United Kingdom
China
