Antibodies

Jump to Filters
View as table Download
PPP3CB Rabbit Polyclonal Antibody
TA308439

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)
PTGER3 Rabbit Polyclonal Antibody
TA313293

USD 380.00

In Stock

Rabbit polyclonal anti-PE2R3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PE2R3.
PPP3CB Rabbit Polyclonal Antibody
TA344738

USD 539.00

5 Days

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS