Rabbit polyclonal antibody to CDC45L (CDC45 cell division cycle 45-like (S. cerevisiae))
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 298 and 566 of CDC45L (Uniprot ID#O75419) |
Rabbit Polyclonal Anti-CDC45
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC45L antibody: synthetic peptide directed towards the C terminal of human CDC45L. Synthetic peptide located within the following region: VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED |
Germany
Japan
United Kingdom
China
