Goat Polyclonal Antibody against DKK1
| Applications | FC, IF, IHC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human WNT3 |
Rabbit polyclonal WNT5B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Rabbit, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit polyclonal WNT10B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT10B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from the Central region of human WNT10B. |
Germany
Japan
United Kingdom
China
