Rabbit Polyclonal Anti-ACE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACE |
Rabbit Polyclonal Anti-ACE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACE |
Anti-AGT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 34-43 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
Rabbit Polyclonal ACE2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the center of human ACE2. |
Rabbit Polyclonal Anti-REN Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human REN |
Rabbit Polyclonal ACE2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the center of human ACE2. |
Anti-ACE2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 556-740 amino acids of human angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 |
Anti-AGT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 34-43 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
Rabbit Polyclonal ACE2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the C-terminus of human ACE2. |
Rabbit Polyclonal ACE2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the N-terminus of human ACE2. |
Rabbit Polyclonal antibody to Angiotensinogen (angiotensinogen (serpin peptidase inhibitor, clade A, member 8))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 476 of Angiotensinogen (Uniprot ID#P01019) |
Rabbit Polyclonal Anti-CMA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CMA1 antibody: synthetic peptide directed towards the C terminal of human CMA1. Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA |
Anti-AGT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 34-41 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
Anti-ACE2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 185-199 amino acids of Human Angiotensin-converting enzyme 2 |
Anti-ACE2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 185-199 amino acids of Human Angiotensin-converting enzyme 2 |
Rabbit Polyclonal LNPEP Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | LNPEP antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human LNPEP. |