Antibodies

Jump to Filters
View as table Download
Thimet Oligopeptidase (THOP1) Rabbit Polyclonal Antibody
TA334392

USD 539.00

5 Days

Rabbit Polyclonal Anti-THOP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THOP1 antibody is: synthetic peptide directed towards the C-terminal region of Human THOP1. Synthetic peptide located within the following region: MDYRSCILRPGGSEDASAMLRRFLGRDPKQDAFLLSKGLQVGGCEPEPQV
Thimet Oligopeptidase (THOP1) Rabbit Polyclonal Antibody
TA361711

USD 539.00

5 Days

THOP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human THOP1