Antibodies

Jump to Filters
View as table Download
ABHD5 Rabbit Polyclonal Antibody
TA301522

USD 550.00

5 Days

Rabbit Polyclonal Antibody against CGI58

Applications Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region within residues 200-300 of the human protein. [Swiss-Prot# Q8WTS1]
ABHD5 Rabbit Polyclonal Antibody
TA321844

USD 380.00

In Stock

Anti-ABHD5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 297 amino acids of human abhydrolase domain containing 5
ABHD5 Rabbit Polyclonal Antibody
TA344120

USD 539.00

5 Days

Rabbit Polyclonal Anti-ABHD5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the C terminal of human ABHD5. Synthetic peptide located within the following region: SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK
ABHD5 Goat Polyclonal Antibody
TA302449

USD 520.00

5 Days

Goat Polyclonal Antibody against CGI58 / ABHD5

Applications WB
Reactivities Mouse, Cow, Human (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-FPERPDLADQDR, from the internal region of the protein sequence according to NP_057090.2.
ABHD5 Rabbit Polyclonal Antibody
TA344119

USD 485.00

5 Days

Rabbit Polyclonal Anti-ABHD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the N terminal of human ABHD5. Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL