Antibodies

View as table Download

Rabbit Polyclonal Anti-ATG4C Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ATG4C

Rabbit polyclonal anti-ATG4C antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATG4C.

Rabbit Polyclonal Anti-ATG4C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATG4C antibody: synthetic peptide directed towards the middle region of human ATG4C. Synthetic peptide located within the following region: TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS