Antibodies

View as table Download

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: QSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLD

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: LHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTF

Rabbit Polyclonal Anti-THR1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-THR1 Antibody: A synthesized peptide derived from human THR1

Rabbit polyclonal TR-β1 (Ser142) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TR-β1 around the phosphorylation site of serine 142 (H-P-SP-Y-S).
Modifications Phospho-specific