Antibodies

View as table Download

Rabbit Polyclonal Anti-GABRB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GABRB1

Rabbit Polyclonal Anti-GABRA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRA1

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRNA1

Anti-GLRA1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1

Anti-HTR3A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 322-455 amino acids of human 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
TA323542 is a possible alternative to TA323541.

Anti-CHRNA3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 69-83 amino acids of Human cholinergic receptor, nicotinic, alpha 3 (neuronal)

Rabbit Polyclonal Anti-GAMT Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GLRA1

Rabbit polyclonal GABRA2 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2.

Rabbit Polyclonal Anti-GABRG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRG2

Rabbit Polyclonal Anti-GABRD Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG

CHRNA1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of Human CHRNA1, identical to the related Rat and Mouse sequence

Goat Anti-CHRNB2 Antibody

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence QPRHHCARQRLR, from the internal region of the protein sequence according to NP_000739.1.

Goat Polyclonal Antibody against Serotonin receptor 3A / HTR3A

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-GPQDFEKSPRDR, from the internal region of the protein sequence according to NP_998786.1; NP_000860.1.

Rabbit polyclonal anti-GABRA4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GABRA4.

Rabbit polyclonal anti-GLRB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLRB.