Antibodies

Jump to Filters
View as table Download
NMBR Rabbit Polyclonal Antibody
TA340753

USD 515.00

2 Weeks

Rabbit Polyclonal Anti-NMBR Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human (Predicted: Monkey, Rat, Dog, Hamster)
Conjugation Unconjugated
Immunogen NMBR antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human NMBR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Panda, Bovine, Bat, Horse, Rabbit, Pig (100%); Marmoset, Rat, Hamster, Dog, Opossum (94%); Platypus (88%); Elephant, Xenopus (81%).
NMBR Rabbit Polyclonal Antibody
TA328625

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-Bombesin Receptor 1

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KSAHNLPGEYNEHTKK, corresponding to amino acid residues 241-256 of human BB1.3rd intracellular loop.
NMBR Rabbit Polyclonal Antibody
TA341019

USD 515.00

5 Days

Rabbit Polyclonal Anti-NMBR Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NMBR antibody was raised against synthetic 19 amino acid peptide from C-terminus of human NMBR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Mouse, Elephant, Bovine (89%); Rat, Panda, Dog, Bat, Rabbit, Pig, Platypus (84%).
NMBR Rabbit Polyclonal Antibody
TA314264

USD 380.00

In Stock

Rabbit polyclonal anti-NMBR antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NMBR.
NMBR (N-term) Rabbit Polyclonal Antibody
AP52896PU-N

USD 580.00

2 Weeks

NMBR (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 1-30aa) of human Neuromedin B receptor
NMBR Rabbit Polyclonal Antibody
TA344313

USD 539.00

5 Days

Rabbit Polyclonal Anti-NMBR Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NMBR antibody: synthetic peptide directed towards the N terminal of human NMBR. Synthetic peptide located within the following region: PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL