GPR40 (FFAR1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 201-250 of Human GPR40. |
GPR40 (FFAR1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 201-250 of Human GPR40. |
GPR40 (FFAR1) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide containing a sequence corresponding to a region within amino acids 239 and 300 of Human GPR40 |
GPR40 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | FFAR1 / GPR40 antibody was raised against synthetic 19 amino acid peptide from 1st cytoplasmic domain of human GPR40. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Mouse, Hamster, Pig (84%). |
Goat Polyclonal Antibody against GPR40
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CAARTQGGKSQK, from the C Terminus of the protein sequence according to NP_005294.1. |
Rabbit Polyclonal Anti-FFAR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FFAR1 antibody: synthetic peptide directed towards the N terminal of human FFAR1. Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV |
GPR40 (FFAR1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 280-300 amino acids from the C-terminal region of human FFAR1 |