Germany
Japan
United Kingdom
China
GPR40 (FFAR1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 201-250 of Human GPR40. |
Antibodies
View as table Download
GPR40 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | FFAR1 / GPR40 antibody was raised against synthetic 19 amino acid peptide from 1st cytoplasmic domain of human GPR40. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Mouse, Hamster, Pig (84%). |
Goat Polyclonal Antibody against GPR40
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CAARTQGGKSQK, from the C Terminus of the protein sequence according to NP_005294.1. |
Rabbit Polyclonal Anti-FFAR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FFAR1 antibody: synthetic peptide directed towards the N terminal of human FFAR1. Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV |
GPR40 (FFAR1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 280-300 amino acids from the C-terminal region of human FFAR1 |
