Rabbit Polyclonal Anti-OR51E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK |
Rabbit Polyclonal antibody to GPR164 (olfactory receptor, family 51, subfamily E, member 1)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 78 and 170 of GPR164 (Uniprot ID#Q8TCB6) |
Rabbit polyclonal anti-OR2A42 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2A42. |
Rabbit Polyclonal anti-OR13C5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the middle region of human OR13C5. Synthetic peptide located within the following region: CGTIFLMYMKPKSQETLNSDDLDATDKLIFIFYRVMTPMMNPLIYSLRNK |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the N terminal of human OR13C5. Synthetic peptide located within the following region: CYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAFD |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR13C5 antibody is: synthetic peptide directed towards the N-terminal region of Human OR13C5. Synthetic peptide located within the following region: ILISILDPHLHTPMYFFLGNLSFLDICYTTTSIPSTLVSFLSERKTISLS |
Rabbit Polyclonal Anti-OR52I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR52I2 Antibody is: synthetic peptide directed towards the N-terminal region of Human OR52I2. Synthetic peptide located within the following region: SSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLLTMAFDRYV |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR13C5 Antibody: synthetic peptide directed towards the N terminal of human OR13C5. Synthetic peptide located within the following region: ICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAF |
Rabbit Polyclonal Anti-OR2A42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR2A42 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2A42. Synthetic peptide located within the following region: FGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL |
Rabbit Polyclonal Anti-OR2C1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2C1 antibody: synthetic peptide directed towards the C terminal of human OR2C1. Synthetic peptide located within the following region: FYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA |
Rabbit Polyclonal Anti-OR2D3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2D3 antibody: synthetic peptide directed towards the C terminal of human OR2D3. Synthetic peptide located within the following region: LKAFSTCGSHLIVVVLFYGSGIFTYMRPNSKTTKELDKMISVFYTAVTPM |
Germany
Japan
United Kingdom
China
