Antibodies

Jump to Filters
View as table Download
PDX1 Rabbit Polyclonal Antibody
TA321081

USD 380.00

In Stock

Anti-PDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1
PDX1 Rabbit Polyclonal Antibody
TA321080

USD 380.00

In Stock

Anti-PDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1
PDX1 Rabbit Polyclonal Antibody
TA336928

USD 550.00

5 Days

Rabbit Polyclonal PDX-1/IPF1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human PDX1 protein (between residues 100-200) [UniProt P52945]
PDX1 Rabbit Polyclonal Antibody
TA324981

USD 580.00

5 Days

Rabbit polyclonal IPF Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the C-terminal region of human IPF.
PDX1 Rabbit Polyclonal Antibody
TA335165

USD 539.00

5 Days

Rabbit Polyclonal Anti-PDX1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDX1 antibody: synthetic peptide directed towards the N terminal of human PDX1. Synthetic peptide located within the following region: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF
PDX1 Rabbit Polyclonal Antibody
TA354608

USD 425.00

5 Days

Rabbit anti PDX-1 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated