Rabbit Polyclonal Anti-ITGA6 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ITGA6 |
Rabbit Polyclonal Anti-ITGA6 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ITGA6 |
Rabbit Polyclonal Anti-ITGAV Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ITGAV antibody is: synthetic peptide directed towards the C-terminal region of Human ITGAV. Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG |
Rabbit polyclonal Catenin-beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1. |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
beta Catenin (CTNNB1) pSer37 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 16 amino acid peptide from near the center of human Integrin alpha 4. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-Actin-pan antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Actin. |
Rabbit polyclonal beta Catenin antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Mouse, Bovine, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LEF1 |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
beta Catenin (CTNNB1) pSer33 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Integrin beta3 (Ab-785) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G). |
Rabbit polyclonal LEF1 Antibody (N-term)
Applications | IF, WB |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1. |
ACTN1 (aa596-609) Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Internal region (TPQEINGKWDHVRQ) |