Antibodies

View as table Download

Goat Anti-Adenosine A2b Receptor Antibody

Applications FC, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQADVKSGNGQ, from the C Terminus of the protein sequence according to NP_000667.1.

Rabbit Polyclonal Anti-ADORA2B Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B.

Rabbit Polyclonal Anti-ADORA2B Antibody (Internal)

Applications IHC
Reactivities Human (Predicted: Monkey, Horse)
Conjugation Unconjugated
Immunogen ADORA2B/Adenosine A2B Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human Adenosine A2b Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Horse (94%); Rabbit (88%); Dog (81%).

Rabbit Polyclonal Anti-ADORA2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADORA2B antibody: synthetic peptide directed towards the C terminal of human ADORA2B. Synthetic peptide located within the following region: AKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHAN