Rabbit Polyclonal Anti-GPD2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPD2 |
Rabbit Polyclonal Anti-GPD2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPD2 |
Rabbit Polyclonal Anti-ACHE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACHE |
Rabbit polyclonal antibody to AChE (acetylcholinesterase (Yt blood group))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 406 and 614 of AChE (Uniprot ID#P22303) |
Anti-PPAP2A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Rabbit Polyclonal Antibody against DGKZ (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DGKZ antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 989-1019 amino acids from the C-terminal region of human DGKZ. |
Rabbit polyclonal ACHE Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ACHE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-175 amino acids from the N-terminal region of human ACHE. |
Rabbit polyclonal LCAT Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This LCAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 285-313 amino acids from the Central region of human LCAT. |
Anti-PPAP2A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Rabbit Polyclonal Anti-DGKZ Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DGKZ |
Rabbit Polyclonal Anti-DGKB Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DGKB |
Rabbit Polyclonal Anti-GNPAT Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GNPAT |
PLA2G2D (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 112-138 amino acids from the C-terminal region of human PLA2G2D |
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Rabbit Polyclonal Anti-LCAT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LCAT antibody: synthetic peptide directed towards the C terminal of human LCAT. Synthetic peptide located within the following region: GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL |
Choline Acetyltransferase (CHAT) (N-term) rabbit polyclonal antibody, Purified
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 98-128 amino acids from the N-terminal region of human CHAT. |